chapter

noun · verbB1

Định nghĩa theo từ loại

Danh từ

noun
Plural noun:
chapterschapiterchapitrechapiturechaptrechapyterchapytrechaptire
  1. 1.

    One of the main sections into which a published work is divided, especially a book.

    Detective novel writers try to keep up the suspense until the last chapter.

  2. 2.

    Certain ecclesiastical bodies (under canon law)

  3. 3.

    A section of a social body.

  4. 4.

    A meeting of a chapter of certain organized societies or orders.

  5. 5.

    A chapter house

  6. 6.

    A sequence (of events), especially when presumed related and likely to continue.

    1866, Wilkie Collins, Armadale, Book the Last, Chapter I, "You know that Mr. Armadale is alive," pursued the doctor, "and you know that he is coming back to England. Why do you continue to wear your widow's dress?" ¶ She answered him without an instant's hesitation, steadily going on with her work. ¶ "Because I am of a sanguine disposition, like you. I mean to trust to the chapter of accidents to the very last. Mr. Armadale may die yet, on his way home."

  7. 7.

    (obsolete)A location or compartment.

  8. 8.

    (Roman Catholicism) A prescribed reading at one of the canonical hours.

    Đồng nghĩa: capitule

Động từ

verb
V_es/s
chapters
V_ing/Gerund
chaptering
V_ed/pp
chapteredchapiter
  1. 1.

    To divide into chapters.

  2. 2.

    To put into a chapter.

  3. 3.

    (military, with "out") To use administrative procedure to remove someone.

  4. 4.

    (transitive)To take to task.

Từ liên quan

Đồng nghĩa

capitulech.chap.chpt.ch., chap., chpt. abbreviations

Cùng gốc / liên quan

chapterfulchapterlikechapterplaychapterwiseinterchaptermicrochaptermidchaptermultichaptersubchapterchapter and versechapter houseto the end of the chapterchapter bookchapter of accidentschapter outdean and chaptergo Chapter 11chapitercapitalcapitalism

Từ có viền nét liền là đã có mục từ; viền nét đứt là chưa có trong dữ liệu.

Nguồn gốc từ

ine-proine-pro From Middle English chapitre, from Old French chapitre, from Latin capitulum, diminutive of caput (a head); see capital capitulum chapiter, which are doublets of chapter.

Nguồn dữ liệu: freedict, dictionary, wiktionary · cập nhật 13/8/2026

Định nghĩa và phiên âm từ Wiktionary / dictionaryapi.dev (CC BY-SA).