poker

noun · verbA2

Định nghĩa theo từ loại

Danh từ

noun
Plural noun:
pokers
  1. 1.

    A metal rod, generally of wrought iron, for adjusting the burning logs or coals in a fire; a firestick.

    Đồng nghĩa: firestick, stoker, fire pike

  2. 2.

    (historical)A tool like a soldering iron for making poker drawings.

  3. 3.

    One who pokes.

  4. 4.

    A kind of duck, the pochard.

  5. 5.

    (Multicultural London English, slang)(MLE, slang) A knife.

    Đồng nghĩa: jook, jooker, ching, ying, bassy, rambo, pokey, chete, shank, nank, splash, splasher, cheffer, wetter

  6. 6.

    (countable, uncountable)(card games) Any of various card games in which, following each of one or more rounds of dealing or revealing cards, the players in sequence make tactical bets or drop out, the bets forming a pool to be taken either by the sole remaining player or, after all rounds and bets have been completed, by those remaining players who hold a superior hand according to a standard ranking of hand values for the game.

  7. 7.

    (countable, uncountable)(card games) All the four cards of the same rank.

  8. 8.

    (countable, rare, uncountable)(soccer, rare) The scoring of four goals by a player in one match.

    Đồng nghĩa: haul

  9. 9.

    (US, colloquial)Any imagined frightful object, especially one supposed to haunt the darkness; a bugbear.

Động từ

verb
V_es/s
pokers
V_ing/Gerund
pokering
V_ed/pp
pokered
  1. 1.

    (transitive)To poke with a utensil such as a poker or needle.

  2. 2.

    To play poker.

Từ liên quan

Đồng nghĩa

firestickstokerfire pikejookjookerchingyingbassyrambopokeycheteshanknanksplashsplasherchefferwetterhaulsilver poker

Cùng gốc / liên quan

pokerishpokerlikepokerworkblow pokepoker machinepai gow pokerfireplace pokerpoverty pokerstraight pokerby the holy pokerdraw pokergas pokerpoker plantred-hot pokerstiff as a pokerwhen the chips are down

Từ có viền nét liền là đã có mục từ; viền nét đứt là chưa có trong dữ liệu.

Nguồn gốc từ

====Noun====

Nguồn dữ liệu: freedict, wiktionary · cập nhật 15/8/2026

Định nghĩa và phiên âm từ Wiktionary / dictionaryapi.dev (CC BY-SA).